Scaffold Ga0066815_10092724

Overview

Basic Information

• Taxon OID: 3300005164
• Scaffold ID: Ga0066815_10092724
• Source Dataset Name: Soil and rhizosphere microbial communities from Laval, Canada - mgLAC
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 558
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Rhizosphere Microbial Communities From Centre Inrs-Institut Armand-Frappier, Laval, Canada

Source Dataset Sampling Location

• Location Name: Laval, Canada
• Coordinates
  • Lat. (^o): 45.54
  • Long. (^o): -73.72

Associated Families

Family	Category	Number of Sequences	3D Structure?
F012922	Metagenome / Metatranscriptome	276	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0066815_100927241	F012922	AGGAGG	MGVGRSDRRSFIKLAAAVPLLTQIAARNLYAQAATAIGKDPRQNVYSRL