Scaffold Ga0066823_10001285

Overview

Basic Information

• Taxon OID: 3300005163
• Scaffold ID: Ga0066823_10001285
• Source Dataset Name: Soil and rhizosphere microbial communities from Laval, Canada - mgHMB
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2872
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Rhizosphere Microbial Communities From Centre Inrs-Institut Armand-Frappier, Laval, Canada

Source Dataset Sampling Location

• Location Name: Laval, Canada
• Coordinates
  • Lat. (^o): 45.54
  • Long. (^o): -73.72

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077882	Metagenome	117	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0066823_100012854	F077882	AGGAG	MKPSALLVAAAIAIVPGIAVAKDQHSAAKSKSQGYGYAYAPMDRSEAIQSCNAEAAKWSYRDFQSTQLTVYRDCMFRHGQSVE*