Scaffold Ga0068711_1013219

Overview

Basic Information

• Taxon OID: 3300005144
• Scaffold ID: Ga0068711_1013219
• Source Dataset Name: Enrichment culture microbial communities from Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKM (Arthur Kill Methanogenic) MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2639
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture → Enrichment Culture Microbial Communities From Rutgers University That Are Mtbe-Degrading

Source Dataset Sampling Location

• Location Name: USA: New Jersey, Arthur Kill intertidal strait
• Coordinates
  • Lat. (^o): 40.58
  • Long. (^o): -74.2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042955	Metagenome / Metatranscriptome	157	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0068711_10132191	F042955	AGGAGG	MNRLVRVMFVAAAAAVIAWLWYSSAPELFRAGMPSITEDADFALLVRLTGFVVIITVGFYFALRNLMKK*