Scaffold Ga0066871_107288

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0066871_107288

Scaffold Ga0066871_107288

Overview

Basic Information
Taxon OID	3300005137 Open in IMG/M
Scaffold ID	Ga0066871_107288 Open in IMG/M
Source Dataset Name	Cellulose-adapted microbial communities from the Joint BioEnergy Institute, USA - Passage3 60B
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	983
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Cellulose-Adapted → Mesophilic And Thermophilic Cellulose-Adapted Microbial Communities From The Joint Bioenergy Institute, California, Usa

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	37.8406114	Long. (^o)	-122.2923487	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021083	Metagenome / Metatranscriptome	220	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0066871_1072882	F021083	AGGAG	MVKKGQLAVSKMDSPRQGERRDPHGEKPKRSRGSRSQTRARPPSEGSSSEG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.