Basic Information | |
---|---|
Taxon OID | 3300005137 Open in IMG/M |
Scaffold ID | Ga0066871_107288 Open in IMG/M |
Source Dataset Name | Cellulose-adapted microbial communities from the Joint BioEnergy Institute, USA - Passage3 60B |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 983 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Cellulose-Adapted → Mesophilic And Thermophilic Cellulose-Adapted Microbial Communities From The Joint Bioenergy Institute, California, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: California | |||||||
Coordinates | Lat. (o) | 37.8406114 | Long. (o) | -122.2923487 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F021083 | Metagenome / Metatranscriptome | 220 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0066871_1072882 | F021083 | AGGAG | MVKKGQLAVSKMDSPRQGERRDPHGEKPKRSRGSRSQTRARPPSEGSSSEG* |
⦗Top⦘ |