Scaffold Ga0068702_100041

Overview

Basic Information

• Taxon OID: 3300005107
• Scaffold ID: Ga0068702_100041
• Source Dataset Name: Cellulose-adapted microbial communities from the Joint BioEnergy Institute, USA - Passage D2F08
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 100213
• Total Scaffold Genes: 97
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 86 (88.66%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Cellulose-Adapted → Mesophilic And Thermophilic Cellulose-Adapted Microbial Communities From The Joint Bioenergy Institute, California, Usa

Source Dataset Sampling Location

• Location Name: USA, Joint Bio-Energy Institute
• Coordinates
  • Lat. (^o): 37.8408
  • Long. (^o): -122.2896

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036417	Metagenome / Metatranscriptome	170	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0068702_10004154	F036417	AGG	LPRRRGFAICFRAMVYPARVPLRTRIPTVLVRLATDDGEVVFRARWTRSPLELQRNILFRMRRGSLLWFQDEWGHDLCFRPECVYAAMVDGR*