Scaffold Ga0062594_101180855

Overview

Basic Information

• Taxon OID: 3300005093
• Scaffold ID: Ga0062594_101180855
• Source Dataset Name: Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 756
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Source Dataset Sampling Location

• Location Name: USA: Michigan
• Coordinates
  • Lat. (^o): 42.4
  • Long. (^o): -85.37
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042599	Metagenome / Metatranscriptome	158	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0062594_1011808551	F042599	AGGAG	MHPLYRPVVLIIWLCAIIIGLNIFVLWWLQTGNPSIHVVSSQAERTPISLVEPPAETAPCEPTVVENDTPLAERDAVIARLQAEIDRLKSMKGDDGAPWRTKAEQFEQELMVLEKAAERVLEMDARNWQE