Scaffold Ga0072334_10777255

Overview

Basic Information

• Taxon OID: 3300005086
• Scaffold ID: Ga0072334_10777255
• Source Dataset Name: Microbial Community from Halfdan Field MHDA3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Shell Corporation
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 500
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Water → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations

Source Dataset Sampling Location

• Location Name: North Sea, Denmark
• Coordinates
  • Lat. (^o): 55.49
  • Long. (^o): 7.42

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054895	Metagenome / Metatranscriptome	139	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0072334_107772551	F054895	GGAGG	MAAITLTGDTLYSQKINNFSGELFRVGGQRTPFLSATGGLNGGKVLQSTFWQIQAADSHVVSSE