Scaffold Ga0068304_1371098

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0068304_1371098

Scaffold Ga0068304_1371098

Overview

Basic Information
Taxon OID	3300005079 Open in IMG/M
Scaffold ID	Ga0068304_1371098 Open in IMG/M
Source Dataset Name	Mastotermes darwiniensis gut microbial communities from Townsville, Australia - TV02
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Queensland
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1027
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (25.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Mastotermes Gut → Termite Gut Microbial Communities From Australia

Source Dataset Sampling Location
Location Name	Townsville, Australia
Coordinates	Lat. (^o)	-19.280075	Long. (^o)	146.824457	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001284	Metagenome	731	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0068304_13710984	F001284	GGTGG	MPLDRSEIQKEAEKKLKHEYEDLSTEIQRIWNLKRFVVPVITGATGIVTKRLQIYLETIPVKHSMDSLRKAALLGTSHIIRKVLQSET*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.