Scaffold Ga0070770_10140808

Overview

Basic Information

• Taxon OID: 3300005078
• Scaffold ID: Ga0070770_10140808
• Source Dataset Name: Microbial Community from Halfdan Field MHBA5
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Shell Corporation
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3283
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (71.43%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Water → Subsurface Hydrocarbon Microbial Communities From Various Worldwide Shell Locations

Source Dataset Sampling Location

• Location Name: North Sea, Denmark
• Coordinates
  • Lat. (^o): 55.49
  • Long. (^o): 7.42

Associated Families

Family	Category	Number of Sequences	3D Structure?
F061293	Metagenome	132	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0070770_101408083	F061293	AGGAGG	MEVKIDKGIPLPSDIRNELKYPFNEMDIGDSIFFPLEGEDNANRMKNRLSQATRTYGKKQTPERHFVIRYRLEDEKSGVRVWRKD*