Basic Information | |
---|---|
Taxon OID | 3300005074 Open in IMG/M |
Scaffold ID | Ga0070431_1258714 Open in IMG/M |
Source Dataset Name | Marine benthic sponge Stylissa massa associated microbial communities from Guam, USA |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Utah |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 548 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Marine Benthic Sponge Stylissa Massa Associated → Stylissa Massa Endosymbiont Microbial Communities From Guam |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Guam | |||||||
Coordinates | Lat. (o) | 13.4388546 | Long. (o) | 144.8224773 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001918 | Metagenome | 617 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0070431_12587141 | F001918 | N/A | YRGDMFAWNSELKYPDDYDPIDHFEQRMKPKQLVWEKYPKFDMSPYKMVSQMEFPLSDDIVRQSIYRQKCQWTSVKKSVDLVDDEFDLVIRMRTDLEFHDRVPLEACKGNGLFMMNGSYQAGAGREYCDWFYCGPHKRVQQFDPLQVFDVFYADGIRHMHDLVIETLRTLQIPHAVLDLKAW |
⦗Top⦘ |