Scaffold Ga0071347_1029701

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0071347_1029701

Scaffold Ga0071347_1029701

Overview

Basic Information
Taxon OID	3300005073 Open in IMG/M
Scaffold ID	Ga0071347_1029701 Open in IMG/M
Source Dataset Name	Cellulose enrichment metagenome from thermal spring in Terrace, British Columbia, Canada
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Leibniz Institute
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1195
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Alkaline → Sediment → Cellulose Enrichment Metagenome From Thermal Spring In Terrace, British Columbia, Canada

Source Dataset Sampling Location
Location Name	Terrace, B.C. Canada
Coordinates	Lat. (^o)	54.358506	Long. (^o)	-128.541159	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076996	Metagenome / Metatranscriptome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0071347_10297011	F076996	GGAGG	MKIDRGLAVYKSSPLLLVVESEEGKLCEVSFKDLKDAGHNFSDAAWKSLVEDYQLFDCQPASR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.