Basic Information | |
---|---|
Taxon OID | 3300005071 Open in IMG/M |
Scaffold ID | Ga0068302_10046262 Open in IMG/M |
Source Dataset Name | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Queensland |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1465 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea → Ectobiidae → Blattellinae → Blattella → Blattella germanica | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Porotermes Gut → Termite Gut Microbial Communities From Australia |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Mount Glorious, Queensland, Australia | |||||||
Coordinates | Lat. (o) | -27.330504 | Long. (o) | 152.763993 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F004009 | Metagenome | 457 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0068302_100462621 | F004009 | GGA | MNETRTVKKIFEEKLGGRRGRGRPRLRWIDDVEDDLRNIGIKRWRIKALDRVEWASIIKEAKAKLKGP* |
⦗Top⦘ |