Scaffold Ga0071082_128671

Overview

Basic Information

• Taxon OID: 3300005058
• Scaffold ID: Ga0071082_128671
• Source Dataset Name: Co-DHS sludge microbial communities
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Illinois, Urbana-Champaign
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2988
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Down-Flow Hanging Sponge Reactor → Down-Flow Hanging Sponge Reactor Microbial Communities From The University Of Illinois At Urbana-Champaign, Usa

Source Dataset Sampling Location

• Location Name: Urbana, Illinois, USA
• Coordinates
  • Lat. (^o): 40.114056
  • Long. (^o): -88.226756

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054971	Metagenome / Metatranscriptome	139	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0071082_1286714	F054971	N/A	IEQGKFPAWVVIIYVVSIVVVAALWLNVAGTLFPSTGGPYAVALTWALCLFGFIFVRTIELFLHRGPHT*