Scaffold Ga0071328_177663

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0071328_177663

Scaffold Ga0071328_177663

Overview

Basic Information
Taxon OID	3300005045 Open in IMG/M
Scaffold ID	Ga0071328_177663 Open in IMG/M
Source Dataset Name	Permafrost microbial communities from Fox Tunnel, Fairbanks, Alaska, USA
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Chicago
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	8419
Total Scaffold Genes	17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	8 (47.06%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost → Permafrost Microbial Communities From Fox Tunnel, Fairbanks, Alaska, Usa

Source Dataset Sampling Location
Location Name	Fairbanks, Alaska, USA
Coordinates	Lat. (^o)	64.953	Long. (^o)	-147.615	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F074429	Metagenome	119	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0071328_17766312	F074429	GGAG	MTKKTTTSFNIDRAISRIAKPSVFDRIVKEVNAKEIPSKYIEQILVQYYDGNIVELKGEELTHPIPVNKNSTWEVMEDSFKKMRDVKIFINTDKLEKDINELVEKYLGNHC*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.