Scaffold Ga0071328_168843

Overview

Basic Information

• Taxon OID: 3300005045
• Scaffold ID: Ga0071328_168843
• Source Dataset Name: Permafrost microbial communities from Fox Tunnel, Fairbanks, Alaska, USA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Chicago
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4307
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost → Permafrost Microbial Communities From Fox Tunnel, Fairbanks, Alaska, Usa

Source Dataset Sampling Location

• Location Name: Fairbanks, Alaska, USA
• Coordinates
  • Lat. (^o): 64.953
  • Long. (^o): -147.615

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038816	Metagenome / Metatranscriptome	165	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0071328_1688432	F038816	N/A	MGTSKTTRLRQQGVAMERASYAKSIPRDLVERAQPIRQAGGTSFMWSLVKIRIACLVLLGAAMPATAGFAVSVSSVKWLCLAWLVGVAILIHRLSRRASADTVVLSIDQRGILDHRLMPRHIEWHEIEAICQVDPNRSHVVDIKLRWPKITLAETRWSVRIGAYCQLGYGVPAVTISTLLLEGNASEIRDAVAQYRPDLLHHANRRAPLIARP*