Scaffold Ga0071328_128975

Overview

Basic Information

• Taxon OID: 3300005045
• Scaffold ID: Ga0071328_128975
• Source Dataset Name: Permafrost microbial communities from Fox Tunnel, Fairbanks, Alaska, USA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Chicago
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5302
• Total Scaffold Genes: 9
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (44.44%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost → Permafrost Microbial Communities From Fox Tunnel, Fairbanks, Alaska, Usa

Source Dataset Sampling Location

• Location Name: Fairbanks, Alaska, USA
• Coordinates
  • Lat. (^o): 64.953
  • Long. (^o): -147.615

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001379	Metagenome / Metatranscriptome	710	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0071328_1289756	F001379	GGAGG	MERSITLAVDVDGDASRIFEILSTTDGQRSFWTADCDVSDRTARFGFVAAPVDLLVDVTTEPDKLVRMRVTSGFPFWDGSTWEWELGDATRAESGTSVLFRHHDFGSGYAEIDLGHTAHTWSLILERLKSYAATGTHQPLFPLATTPSTT*