Scaffold Ga0068518_1028658

Overview

Basic Information

• Taxon OID: 3300005002
• Scaffold ID: Ga0068518_1028658
• Source Dataset Name: Wastewater microbial communities from Nanji, Korea with extracellular vesicles - Nanji-0.2um
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Chunlab, Inc
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 795
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater → Marine And Wastewater Microbial Communities From Korea, With Extracellular Vesicles

Source Dataset Sampling Location

• Location Name: Nanji, South Korea
• Coordinates
  • Lat. (^o): 37.3132
  • Long. (^o): 126.828

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078624	Metagenome / Metatranscriptome	116	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0068518_10286581	F078624	GGAG	MKLCIHVRPRDDGQGWAVDVFDGRRAWTKTHLGESPLNKAEAHRLAHKLRDPKFYTSRTKRAVNSLTVERGPKGGAA*