Basic Information | |
---|---|
Taxon OID | 3300004951 Open in IMG/M |
Scaffold ID | Ga0068513_1001736 Open in IMG/M |
Source Dataset Name | Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-EVs |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Chunlab, Inc |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2271 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water → Marine And Wastewater Microbial Communities From Korea, With Extracellular Vesicles |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | East Sea, Korea | |||||||
Coordinates | Lat. (o) | 37.0 | Long. (o) | 131.0 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F049284 | Metagenome | 147 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0068513_10017362 | F049284 | AGGTGG | MSLYKTKTQKKNALLSIHSKAMKLFASGAISMKDAENISKIVNMRKKQL* |
⦗Top⦘ |