Scaffold Ga0068517_1012682

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0068517_1012682

Scaffold Ga0068517_1012682

Overview

Basic Information
Taxon OID	3300004901 Open in IMG/M
Scaffold ID	Ga0068517_1012682 Open in IMG/M
Source Dataset Name	Wastewater microbial communities from Nanji, Korea with extracellular vesicles - Nanji-EVs
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Chunlab, Inc
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	911
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater → Marine And Wastewater Microbial Communities From Korea, With Extracellular Vesicles

Source Dataset Sampling Location
Location Name	Nanji, South Korea
Coordinates	Lat. (^o)	37.3132	Long. (^o)	126.828	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F046373	Metagenome / Metatranscriptome	151	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0068517_10126823	F046373	GGAGG	MINSFKAESHCFVVAHNNVDDYRICELDAGNELSSLLPHFEQFDTYELALARVPVEFRPNDEQL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.