Scaffold Ga0068517_1005619

Overview

Basic Information

• Taxon OID: 3300004901
• Scaffold ID: Ga0068517_1005619
• Source Dataset Name: Wastewater microbial communities from Nanji, Korea with extracellular vesicles - Nanji-EVs
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Chunlab, Inc
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1409
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Agitococcus → Agitococcus lubricus (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater → Marine And Wastewater Microbial Communities From Korea, With Extracellular Vesicles

Source Dataset Sampling Location

• Location Name: Nanji, South Korea
• Coordinates
  • Lat. (^o): 37.3132
  • Long. (^o): 126.828

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032274	Metagenome / Metatranscriptome	180	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0068517_10056194	F032274	N/A	EARQDWQRAPKIIVTEEYIALDKKLEPIEEELFELIKKMPLAIEKKIKGKICVIPSGLKTDEYLISRVRELRKQASKIGKELDELFFKTNPEWAKFYEYTD*