Scaffold Ga0068515_100676

Overview

Basic Information

• Taxon OID: 3300004829
• Scaffold ID: Ga0068515_100676
• Source Dataset Name: Marine water microbial communities from the Pohang Bay, Korea with extracellular vesicles - Pohang-EVs
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Chunlab, Inc
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4364
• Total Scaffold Genes: 14
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 9 (64.29%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → unclassified viruses → Circular genetic element sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Water → Marine And Wastewater Microbial Communities From Korea, With Extracellular Vesicles

Source Dataset Sampling Location

• Location Name: South Korea: Pohang-si, Gyeongsangbuk-do
• Coordinates
  • Lat. (^o): 36.03776
  • Long. (^o): 129.386

Associated Families

Family	Category	Number of Sequences	3D Structure?
F049284	Metagenome	147	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0068515_1006768	F049284	GAGG	MYRTKTQKRNALKSIQSKSMKLFSTGCMSMKDADAISRIVNSNLKRL*