Scaffold Ga0068515_100175

Overview

Basic Information

• Taxon OID: 3300004829
• Scaffold ID: Ga0068515_100175
• Source Dataset Name: Marine water microbial communities from the Pohang Bay, Korea with extracellular vesicles - Pohang-EVs
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Chunlab, Inc
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 8919
• Total Scaffold Genes: 13
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (15.38%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium SG8_47 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Water → Marine And Wastewater Microbial Communities From Korea, With Extracellular Vesicles

Source Dataset Sampling Location

• Location Name: South Korea: Pohang-si, Gyeongsangbuk-do
• Coordinates
  • Lat. (^o): 36.03776
  • Long. (^o): 129.386

Associated Families

Family	Category	Number of Sequences	3D Structure?
F102846	Metagenome	101	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0068515_1001756	F102846	N/A	MIQHIKHTIKQRATHLLDVWKYSDSQPTEITLALVNLLLAPIATRIELGPLVFYQITLVVSGVYQLMCVAKGDLKCRVRASIVTFGLFSTTLMMYVVTIGLPTPSHWGWCVLVFSAFGSLKRLKTEQLHRHE*