Scaffold Ga0070915_102054

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0070915_102054

Scaffold Ga0070915_102054

Overview

Basic Information
Taxon OID	3300004817 Open in IMG/M
Scaffold ID	Ga0070915_102054 Open in IMG/M
Source Dataset Name	Hypersaline lake viral communities from Bras del Port, Santa Pola, Alicante, Spain - SAL2 dirigido Enero 2015
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Alicante
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	515
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline Lake → Hypersaline Lake Viral Communities From Bras Del Port, Santa Pola, Alicante, Spain

Source Dataset Sampling Location
Location Name	Spain
Coordinates	Lat. (^o)	38.19317	Long. (^o)	-0.59268	Alt. (m)		Depth (m)	58.6
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F065465	Metagenome	127	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0070915_1020542	F065465	AGGA	MTEDITVVCECDVLEEARSMGYRRYADMTAADIVAAWPVHYTEHGSWDSHILPTLRCLAGYGDRGYGTYQERQDVALIQDGDEADMPADAIILDSGHLLDDLIDAWHSGRHQAITDTLRQ

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.