NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0058861_10022282

Scaffold Ga0058861_10022282


Overview

Basic Information
Taxon OID3300004800 Open in IMG/M
Scaffold IDGa0058861_10022282 Open in IMG/M
Source Dataset NameSwitchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)671
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Switchgrass Rhizosphere And Bulk Soil Microbial Communities From Kellogg Biological Station, Michigan, Usa For Expression Studies

Source Dataset Sampling Location
Location NameKellogg Biological Station, Michigan, USA
CoordinatesLat. (o)42.3912Long. (o)-85.383786Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F058597Metagenome / Metatranscriptome134Y

Sequences

Protein IDFamilyRBSSequence
Ga0058861_100222821F058597N/AYESKTYQNAVLPSYQHYDCDATAATCYAPKSYGKSYTANEYTYKRAYPYPGPKDRFKAKLKKIGSAITGLINKILGKFHHTWIHFKEKWNEHCSIIKSDIARFADWKACEKEKFKSWWGYHVDLIRTKKALWDDAMREFHRQWCHYKKTAREEYEKKKADCGIKEKDYDDADEYSSKVNYYGVTPVEDHYSNYSSSGKYKPEEYKKTADLDD*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.