Scaffold Ga0007756_11536768

Overview

Basic Information

• Taxon OID: 3300004795
• Scaffold ID: Ga0007756_11536768
• Source Dataset Name: Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 542
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location

• Location Name: Lake Michigan, USA
• Coordinates
  • Lat. (^o): 43.1998
  • Long. (^o): -86.5698

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080515	Metagenome / Metatranscriptome	115	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0007756_115367681	F080515	GGAG	LDIVEVDGRPIDFKKNPFETLFFENTNPTSTTKRTIKLKNSSPILVPFHWSVYKSKFTNMISLMDDQAHYKVEPVQGKI*