Scaffold Ga0007761_10027779

Overview

Basic Information

• Taxon OID: 3300004792
• Scaffold ID: Ga0007761_10027779
• Source Dataset Name: Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 754
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location

• Location Name: Lake Michigan, USA
• Coordinates
  • Lat. (^o): 43.1998
  • Long. (^o): -86.5698

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011569	Metagenome / Metatranscriptome	289	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0007761_100277791	F011569	N/A	ELKYGSGISKVLRDHERQTEIYWLAWECLRRANVTVPLFGIEFIDSLDTVEVLDEEKK*