Scaffold Ga0068459_107210

Overview

Basic Information

• Taxon OID: 3300004791
• Scaffold ID: Ga0068459_107210
• Source Dataset Name: Porphyra umbilicalis microbial communities from the coast of Maine, USA, in Atlantic Ocean
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: HudsonAlpha Institute for Biotechnology
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2932
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Rhodophyta → Bangiophyceae → Bangiales → Bangiaceae → Porphyra → Porphyra umbilicalis (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Algae → Red Algae → Unclassified → Unclassified → Porphyra Umbilicalis → Porphyra Umbilicalis Symbiont Microbial Communities From The Coast Of Maine, Usa, In Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Trenton, Maine, United States
• Coordinates
  • Lat. (^o): 44.4
  • Long. (^o): -68.4

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013269	Metagenome	272	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0068459_1072103	F013269	AGGAG	VVTGDALFLPVNVNDERVGIRIRVNNYEGFNGLALQLVLLIVVGRIDVVSDLDVRIASCDPVVKVTFVTLLRLTQGLDNDRDLPAKAGHELSFAI*