Scaffold Ga0062388_101738675

Overview

Basic Information

• Taxon OID: 3300004635
• Scaffold ID: Ga0062388_101738675
• Source Dataset Name: Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 638
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium TAA 166 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil → Bog Forest Soil Microbial Communities From Calvert Island, British Columbia, Canada

Source Dataset Sampling Location

• Location Name: Calvert Island, British Columbia, Canada
• Coordinates
  • Lat. (^o): 51.62
  • Long. (^o): -128.09

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043353	Metagenome / Metatranscriptome	156	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0062388_1017386752	F043353	GGAGG	MQVLLYMVFFTTFTWFVVTVQNHRRLLALTLAGVMVVTLVGAPKPAQAQLGILGAIQAVLNVINGVIQTALTSINTVRTELNNLQQLVVWPQQLINQARALVTQMIGQYRNLMSNIFHIKLNSATLPNPQALEAVIRDH