Scaffold Ga0058864_1534215

Overview

Basic Information

• Taxon OID: 3300004624
• Scaffold ID: Ga0058864_1534215
• Source Dataset Name: Wastewater treatment Type I Accumulibacter community from EBPR Bioreactor in Madison, WI, USA - TNR Reactor, Time B -10min-Anaerobic_ RNA (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 667
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Wastewater Treatment → Wastewater Treatment Type I Accumulibacter Community From Ebpr Bioreactor In Madison, Wi, Usa

Source Dataset Sampling Location

• Location Name: Madison, Wisconsin, USA
• Coordinates
  • Lat. (^o): 43.076217
  • Long. (^o): -89.411742

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051950	Metagenome / Metatranscriptome	143	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0058864_15342151	F051950	N/A	STEATYQLNFNVGFSTTRSDVLVHLSQ*QY***F*FAFL*CFYYLFSARVVRYRSLKMRPKIVTSFRPHGK*GDFLAAIIPAI*CLNILSNSNFILRLIE*QNEASLFTVRVRARQ*YWVYKFELKNFTDILTAPKNVGYNR*TVNTFGDLQVAEDYLYMLQLRSQNN*VKSY*TEVLKTAGDVKKNHIVAPQEQLSLEITNQAKTNIINNKINSLNLNAL