Scaffold Ga0066508_1126111

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0066508_1126111

Scaffold Ga0066508_1126111

Overview

Basic Information
Taxon OID	3300004590 Open in IMG/M
Scaffold ID	Ga0066508_1126111 Open in IMG/M
Source Dataset Name	Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metatranscriptome 28_LOW6 (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	616
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Freshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension

Source Dataset Sampling Location
Location Name	USA: Lake Washington, Seattle, Washington
Coordinates	Lat. (^o)	48.3807	Long. (^o)	-122.1599	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017072	Metagenome / Metatranscriptome	243	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0066508_11261111	F017072	N/A	DNPRRLGKSQVRLVDLAPLKPGRKARQRRQDSPVPLAVFAHRQTRMRDLAARDDEKPFRTESSNPGKFRFRMNRSHPEGGKLLLCISTVRTTLAGSHETGTAQRKTPKGGQKERTHREEHGNLAGSVKNFRAPAMLKTTPLDCEIKGSLREKRRDPWPRANAPSQAVADPEPVVKTRTKIRRRVLTWFASRWRNHQPKRAEKPH

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.