NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066508_1013145

Scaffold Ga0066508_1013145


Overview

Basic Information
Taxon OID3300004590 Open in IMG/M
Scaffold IDGa0066508_1013145 Open in IMG/M
Source Dataset NameFreshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metatranscriptome 28_LOW6 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)760
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Freshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension

Source Dataset Sampling Location
Location NameUSA: Lake Washington, Seattle, Washington
CoordinatesLat. (o)48.3807Long. (o)-122.1599Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001633Metagenome / Metatranscriptome660Y
F025923Metagenome / Metatranscriptome199Y

Sequences

Protein IDFamilyRBSSequence
Ga0066508_10131451F025923N/ASKRSGLKDVAESTAGIIPGDRGMAGGSWCRPPLQAAKAE*
Ga0066508_10131452F001633N/ALAFAGGVLPDATLRGMRMFRSHGGTVLTVTGRDLSSEASAPGSATPCRERHARRGADTPAIFIVSRRHRYHGDGTSFWLAVGPALRV*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.