Scaffold Ga0068979_1001605

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0068979_1001605

Scaffold Ga0068979_1001605

Overview

Basic Information
Taxon OID	3300004558 Open in IMG/M
Scaffold ID	Ga0068979_1001605 Open in IMG/M
Source Dataset Name	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 76 (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	571
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil → Peatlands Soil Microbial Communities From Germany And Austria, That Are Sulfate Reducing

Source Dataset Sampling Location
Location Name	Germany: Weissenstadt
Coordinates	Lat. (^o)	50.13	Long. (^o)	11.88	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080984	Metagenome / Metatranscriptome	114	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0068979_10016052	F080984	GGAG	MFRIKVALALIVLAASIATAKVMAQDTKVMAQNTSNRSIGTHQIDRFEAIHMLQESLKSNPNDAAAWIVLGELAHEVAQDLSSQDDEPYYKLSEEAYEKALALQPKNAGLK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.