Scaffold Ga0069718_16160675

Overview

Basic Information

• Taxon OID: 3300004481
• Scaffold ID: Ga0069718_16160675
• Source Dataset Name: Combined Assembly of Gp0112041, Gp0112042, Gp0112043
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: The National High-throughput DNA Sequencing Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 648
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment → Urban Pond Sediment Microbial Communities From Copenhagen, Denmark

Source Dataset Sampling Location

• Location Name: Copenhagen, Denmark
• Coordinates
  • Lat. (^o): 55.685937
  • Long. (^o): 12.574205

Associated Families

Family	Category	Number of Sequences	3D Structure?
F100685	Metagenome	102	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0069718_161606751	F100685	N/A	GRVDCPHLPECGHDCHYDTAQVRKVKPYPVVPEDIEPVPDTWHTVGTLMLTAIMGALAVVCILIFFTGFWVWSLLI*