NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0069718_15067004

Scaffold Ga0069718_15067004


Overview

Basic Information
Taxon OID3300004481 Open in IMG/M
Scaffold IDGa0069718_15067004 Open in IMG/M
Source Dataset NameCombined Assembly of Gp0112041, Gp0112042, Gp0112043
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterThe National High-throughput DNA Sequencing Centre
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3753
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (50.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment → Urban Pond Sediment Microbial Communities From Copenhagen, Denmark

Source Dataset Sampling Location
Location NameCopenhagen, Denmark
CoordinatesLat. (o)55.685937Long. (o)12.574205Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001059Metagenome / Metatranscriptome790Y
F006264Metagenome / Metatranscriptome377Y
F015330Metagenome / Metatranscriptome255Y
F027490Metagenome / Metatranscriptome194Y

Sequences

Protein IDFamilyRBSSequence
Ga0069718_150670042F015330AGAAGGMSEVKDLKKAMRVAKGQKEPRPRGRPKSIVNRVTEYGALFNSLNDERATKGLPPLKTAMEVLIEAMQSEELDFRDKARIADKLAAYESSRAPVISIEHVQNMKTDEDVDAEEALDDFLEALRKV*
Ga0069718_150670045F027490GAGGMSYGKVINGGAQMRKGLTKGVNDKLSSRSKEDSRRQSVATAVGNAYKVDTLSSQHTNNVNGGKFQKPSVPKNI*
Ga0069718_150670046F001059N/AMVANSKNPQFRKTFNKGISMATYDIESLKADLPTAKELAQFVYDRTQIALDLIGKPKDDQYVVAKAALEGKKIPSEFLTDENPYVDRKELVPEDPIPALPPRSEDLPSPDSQVHFFGATNMPHPLDPQSDRKVHISFRKYENNVITYQVMGPLEKQAVGSRINKYGQNVPEKYTWMDPRTEERLMRNADGTFTAQGRGLYAYCVGEKGGGIWPLIDREVVSIAEKNIANPWA*
Ga0069718_150670047F006264N/AMDYASIFRDKLAGQAEVCARKTLERLQKNLHNETELTPEDIFYLASAAQILLNVRDTYGKK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.