NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0068919_1250520

Scaffold Ga0068919_1250520


Overview

Basic Information
Taxon OID3300004473 Open in IMG/M
Scaffold IDGa0068919_1250520 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 4 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1147
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium 13_1_20CM_54_36(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil → Peatlands Soil Microbial Communities From Germany And Austria, That Are Sulfate Reducing

Source Dataset Sampling Location
Location NameGermany: Weissenstadt
CoordinatesLat. (o)50.13Long. (o)11.88Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005640Metagenome / Metatranscriptome394Y
F045405Metagenome / Metatranscriptome153Y

Sequences

Protein IDFamilyRBSSequence
Ga0068919_12505201F005640AGGAGMAAPGTEKYEHAETEKALETLTKWGKNPNIDGGENIGFSVSRQGAPSDAFMGMGDCTPFTPSGHRGTLHGQPVGDTGVPVAYFDNFGGAVPTINQVPFTFAFDLNSGKVSMNGAFPGLPANLEFRVEYLKEFDGAGGKNIVFTSDKTSDHAGYVLAVQLVGAS*
Ga0068919_12505202F045405AGGAGMARLGIGVIARYGNWYHGDDDFFTHCLILKNGECWLLGQGLEQVILRVFKARHSKFKQLKTALASIPAGWATASYSGYNFITDAESATASEIAVYGKKTGGALAGYFVPPAGSVVEGLVKAIAHID*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.