Basic Information | |
---|---|
Taxon OID | 3300004463 Open in IMG/M |
Scaffold ID | Ga0063356_103741799 Open in IMG/M |
Source Dataset Name | Combined assembly of Arabidopsis thaliana microbial communities |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 655 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere → Arabidopsis Thaliana Rhizosphere Microbial Communities From The Joint Genome Institute, Usa, That Affect Carbon Cycling |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Walnut Creek, California | |||||||
Coordinates | Lat. (o) | 37.931388 | Long. (o) | -122.021761 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F065827 | Metagenome / Metatranscriptome | 127 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0063356_1037417993 | F065827 | N/A | MIKDLTRTCDMCHKMIPSGEYVQRNSDRNGPDVMMVLVENEDRELRLIELPDGSISLDTCWSCYTRMPF |
⦗Top⦘ |