NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066222_1023693

Scaffold Ga0066222_1023693


Overview

Basic Information
Taxon OID3300004460 Open in IMG/M
Scaffold IDGa0066222_1023693 Open in IMG/M
Source Dataset NameMarine viral communities from Newfoundland, Canada BC-1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterYale University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1530
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Viral Communities From Newfoundland, Canada

Source Dataset Sampling Location
Location NameNewfoundland, Canada
CoordinatesLat. (o)47.593411Long. (o)-52.885466Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F038422Metagenome166N

Sequences

Protein IDFamilyRBSSequence
Ga0066222_10236933F038422GGAGGMRVEIYFQMPSGIRLSITQGVGMMGDRDRGSIEVGVLDDKGNLIGDPRGYVDGSQLHQILEGML*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.