Scaffold Ga0066224_1149778

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0066224_1149778

Scaffold Ga0066224_1149778

Overview

Basic Information
Taxon OID	3300004457 Open in IMG/M
Scaffold ID	Ga0066224_1149778 Open in IMG/M
Source Dataset Name	Marine viral communities from Newfoundland, Canada MC-1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Yale University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	647
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine → Marine Viral Communities From Newfoundland, Canada

Source Dataset Sampling Location
Location Name	Newfoundland, CA
Coordinates	Lat. (^o)	47.65117	Long. (^o)	-52.695961	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F103049	Metagenome / Metatranscriptome	101	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0066224_11497782	F103049	GAGG	MKTMTQKTMIKNLAAKFGIPAVSAEEFYGYKHDGIWCRGDICTELTDYYPYAEGTMQDNKLNTFLHSKGWFAEPYDNETIMFHKG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.