Scaffold Ga0066231_104969

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0066231_104969

Scaffold Ga0066231_104969

Overview

Basic Information
Taxon OID	3300004327 Open in IMG/M
Scaffold ID	Ga0066231_104969 Open in IMG/M
Source Dataset Name	Sediment microbial communities from the mangroves in Sao Paulo State, Brazil - MgvRC2B
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	573
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Mangrove Sediment → Metatranscriptomics Studies In Sediment Microbial Communities From The Mangroves In Sao Paulo, Brazil

Source Dataset Sampling Location
Location Name	Sao Paulo State, Brazil
Coordinates	Lat. (^o)	-23.8553	Long. (^o)	-46.1394	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016975	Metagenome / Metatranscriptome	243	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0066231_1049692	F016975	GGTGG	VVKTRRLITDVSWPGSQAGGATTSQSELKSLTQEFSSGNALDGPATRPKTPLAVENSVG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.