Scaffold Ga0066599_101244413

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0066599_101244413

Scaffold Ga0066599_101244413

Overview

Basic Information
Taxon OID	3300004282 Open in IMG/M
Scaffold ID	Ga0066599_101244413 Open in IMG/M
Source Dataset Name	Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	558
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater → Freshwater Pond Sediment Microbial Communities From The University Of Edinburgh, Under Environmental Carbon Perturbations

Source Dataset Sampling Location
Location Name	Crawford Collection of the Royal Observatory Edinburgh
Coordinates	Lat. (^o)	55.9232	Long. (^o)	-3.1878	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077414	Metagenome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0066599_1012444131	F077414	N/A	DRHDFERWDWREAATALEVPAAKSGRLLVLQDAVHEAARNWPGRGRASV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.