Scaffold Ga0066599_100687882

Overview

Basic Information

• Taxon OID: 3300004282
• Scaffold ID: Ga0066599_100687882
• Source Dataset Name: Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 701
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater → Freshwater Pond Sediment Microbial Communities From The University Of Edinburgh, Under Environmental Carbon Perturbations

Source Dataset Sampling Location

• Location Name: Crawford Collection of the Royal Observatory Edinburgh
• Coordinates
  • Lat. (^o): 55.9232
  • Long. (^o): -3.1878

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060338	Metagenome / Metatranscriptome	133	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0066599_1006878821	F060338	N/A	QKPKFCGETPSACALFLTKKVFKLLKIMLYAPLEQFQILLLFSIELFCLNFSINNLALLNSLVSLFFGGIVLLFNSNVN*