Scaffold Ga0066605_10380452

Overview

Basic Information

• Taxon OID: 3300004279
• Scaffold ID: Ga0066605_10380452
• Source Dataset Name: Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 509
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location

• Location Name: British Columbia, Canada
• Coordinates
  • Lat. (^o): 48.6
  • Long. (^o): -123.5
  • Depth (m): 10

Associated Families

Family	Category	Number of Sequences	3D Structure?
F046023	Metagenome / Metatranscriptome	152	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0066605_103804522	F046023	N/A	KKKEDEWKEHQFIYDGYKFIMNYNKKDFNIAHELTGKIITKGNFKE*