NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0066605_10213394

Scaffold Ga0066605_10213394


Overview

Basic Information
Taxon OID3300004279 Open in IMG/M
Scaffold IDGa0066605_10213394 Open in IMG/M
Source Dataset NameMarine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)735
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location NameBritish Columbia, Canada
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)Depth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020254Metagenome / Metatranscriptome225Y
F021734Metagenome / Metatranscriptome217Y
F049421Metagenome / Metatranscriptome146Y

Sequences

Protein IDFamilyRBSSequence
Ga0066605_102133941F020254N/AMETLWTVAAPAWQWILGTAVALYVWEEYLEHVWYKFKHWVLNEPHNSK*
Ga0066605_102133942F049421N/AVIEVIVAIIGLGVGDYADPLDLNLEDKDKKVIIQSACEETTTHDIYGQVNTIKTCRTMKTIHTTEEKD*
Ga0066605_102133943F021734AGGAGMEVLAIIGLIAGVGYGMDNDWKVAKAYHSYENCRVDNPKVQNTMTSWQYDPCNLAAYQVKNLTEEK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.