Scaffold Ga0066609_10107470

Overview

Basic Information

• Taxon OID: 3300004278
• Scaffold ID: Ga0066609_10107470
• Source Dataset Name: Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_150m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 916
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → environmental samples → uncultured marine bacterium 580 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location

• Location Name: British Columbia, Canada
• Coordinates
  • Lat. (^o): 48.6
  • Long. (^o): -123.5
  • Depth (m): 150

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004164	Metagenome / Metatranscriptome	450	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0066609_101074702	F004164	AGGAG	MTYMNTLRLIIFLLFLPIMGQASEDLKYSYVHDSIGDRDDADGDVTFRTHQDNGVMYEYAHVNIKWKGGFFKSTITDDFIQKKEIKNGLVLYDIVEGDQKKGYSVFSRHIDVKNYPVGFETKKIINDEGRHPAFSDYDWIFKFKAESVESIQINGQMRKSIHTKLWGSRPTSTTNCRMTQPGMNFSNSTGEIHVETWFDLQNNKLLKQVFTK