NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0055457_10074971

Scaffold Ga0055457_10074971


Overview

Basic Information
Taxon OID3300004266 Open in IMG/M
Scaffold IDGa0055457_10074971 Open in IMG/M
Source Dataset NameWetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)873
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands → Natural And Restored Wetland Microbial Communities From The San Francisco Bay, California, Usa, That Impact Long-Term Carbon Sequestration

Source Dataset Sampling Location
Location NameUSA: San Francisco Bay, California
CoordinatesLat. (o)38.197227Long. (o)-122.010124Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F091542Metagenome107Y
F093449Metagenome106N

Sequences

Protein IDFamilyRBSSequence
Ga0055457_100749711F091542AGGAMKLRIGNACWHAFHIQHAFLCQEAGFFAQEGIDTEIVHAKINPKGIDASRPEGERYDEVG
Ga0055457_100749712F093449GAGGMKLRVGNACWHAFHVQHALLCREAGFYAQEGIDVEIVHARINPKAIESSRPGGERYDEVGTVLRDMIAYGIDIIPDVHVRTPFAERVLGNDEVVIIGGWRNHYGGTAMGAPSIKSMGDLKGKRIGDWYKGGIHTMWWERQLRQA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.