Scaffold Ga0051981_10325695

Overview

Basic Information

• Taxon OID: 3300004265
• Scaffold ID: Ga0051981_10325695
• Source Dataset Name: Groundwater microbial communities from aquifer in Utah, USA - Crystal Geyser 4/10/14 3 um filter
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 538
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → unclassified Nitrososphaeria → Nitrososphaeria archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Development Of A Pipeline For High-Throughput Recovery Of Near-Complete And Complete Microbial Genomes From Complex Metagenomic Datasets

Source Dataset Sampling Location

• Location Name: USA: Utah
• Coordinates
  • Lat. (^o): 38.9383
  • Long. (^o): -110.1342

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011639	Metagenome	288	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0051981_103256951	F011639	N/A	VWIKKKYVRPRLSPDELWLIYRLIDNQYWLLRKHPHPFRSLEEVSRLRRKILRLVNRCRKPKHQISLRQRLY*