Scaffold Ga0062590_100310788

Overview

Basic Information

• Taxon OID: 3300004157
• Scaffold ID: Ga0062590_100310788
• Source Dataset Name: Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1234
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Source Dataset Sampling Location

• Location Name: Wisconsin, United States
• Coordinates
  • Lat. (^o): 43.2958
  • Long. (^o): -89.3799

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009227	Metagenome / Metatranscriptome	321	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0062590_1003107884	F009227	GGTGG	MLGLEPFEKSRFPFITIPYLAGMPFAGALGAYLSRRMKGSVVERILSALFPVFTLATFFAVSIVYELLFEGTPPTLPHFLAGLSVTFKFAISGGLLLVLGAWPFCRSQLREQSP*