Scaffold Ga0066602_10446435

Overview

Basic Information

• Taxon OID: 3300004151
• Scaffold ID: Ga0066602_10446435
• Source Dataset Name: Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 5
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 585
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium PtaB.Bin038 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater → Freshwater Pond Sediment Microbial Communities From The University Of Edinburgh, Under Environmental Carbon Perturbations

Source Dataset Sampling Location

• Location Name: University of Edinburgh
• Coordinates
  • Lat. (^o): 55.9225
  • Long. (^o): -3.1724

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042955	Metagenome / Metatranscriptome	157	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0066602_104464352	F042955	GGAGG	MSRLIRFTLVAGAAAMLAWLWFTAWPELFRDGMPSITEDADFALLVRLTGFVVILATALYFAVKNLMKK*