Scaffold Ga0058901_1484120

Overview

Basic Information

• Taxon OID: 3300004120
• Scaffold ID: Ga0058901_1484120
• Source Dataset Name: Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF238 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 625
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Harvard Forest Long Term Ecological Research (Lter) Site In Petersham, Ma, For Long-Term Soil Warming Studies

Source Dataset Sampling Location

• Location Name: Harvard Forest LTER, Petersham, MA, USA
• Coordinates
  • Lat. (^o): 42.531427
  • Long. (^o): -72.189946

Associated Families

Family	Category	Number of Sequences	3D Structure?
F071429	Metagenome / Metatranscriptome	122	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0058901_14841201	F071429	AGGAG	MTSNPELYFDPVSEGVCEVLDCSNPARFRASWVQGVIVRLVCSTHKAEVEGKSFGELSPSTFGLRRRGK*