Scaffold Ga0065183_10178734

Overview

Basic Information

• Taxon OID: 3300004113
• Scaffold ID: Ga0065183_10178734
• Source Dataset Name: Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_12 (version 2)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 887
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location

• Location Name: Helgoland, North Sea, Atlantic Ocean
• Coordinates
  • Lat. (^o): 53.9944
  • Long. (^o): 6.8905
  • Depth (m): 29

Associated Families

Family	Category	Number of Sequences	3D Structure?
F063710	Metagenome	129	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0065183_101787342	F063710	GGA	MTKPRQRSLRVRVEHEPNRFSDDCLERIYEQLHPTKSRKVTPDNTNEQGEVEPQKGKGDRQ*